Name:
Fc γ RIIIa/CD16a Protein
Synonyms:
Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A, CD16a Antigen, Fc-Gamma RIII-Alpha, Fc-Gamma RIII, Fc-gamma RIIIa, FcRIII, FcRIIIa, FcR-10, IgG Fc Receptor III-2, CD16a, FCGR3A, CD16A, FCG3, FCGR3, IGFR3
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
P08637-1
Gene Id:
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVPTISSFFPPGYQGGGSGGGSHHHHHHHHHH
Molecular Weight:
35-45 kDa(Reducing)
Purity:
>95%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
IgG Fc receptor (Fc γ R) is a member of the Ig superfamily, which plays a role in activating or inhibiting immune response. Human Fc γ Rs can be divided into three types: RI (CD64), RII (CD32) and RIII (CD16). CD16 is a low-affinity Fc receptor, which has been identified as Fc γ RIII (a (CD16a) and Fc γ RIIIb (CD16b), respectively. These receptors bind to the Fc portion of the IgG antibody and are encoded by two different highly homologous genes in a cell type-specific manner. In humans, CD16a is a 50-70 kDa type I transmembrane activated receptor expressed in NK cells, T cells, monocytes and macrophages, involved in phagocytosis, secretion of enzymes and inflammatory mediators, antibody-dependent cytotoxicity and clearance of immune complexes. Abnormal expression or mutation of CD16a is associated with susceptibility to viral infection, systemic lupus erythematosus and neutropenia in alloimmune newborns. In humans, mutations in a single amino acid of CD16a may affect susceptibility to autoimmune diseases or response to therapeutic IgG antibodies.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
AG-2 Protein
PTPMT1 Protein
Popular categories:
SMAD1
Muscle-Specific Kinase (MuSK)
