Name:
Biotinylated CD47 Protein
Synonyms:
Biotinylated CD47 Fc Chimera protein;antigen identified by monoclonal 1D8, Antigenic surface determinant protein OA3, CD47 antigen (Rh-related antigen, integrin-associated signal transducer), CD47 antigen, CD47 glycoprotein, CD47 molecule, CD47, IAP, IAPintegrin associated protein, Integrin-associated protein, leukocyte surface antigen CD47, MER6, MER6integrin-associated signal transducer, OA3, Protein MER6, Rh-related antigen
Species Name:
Human
Label Name:
Human Fc Tag
Marker Name:
Biotin
Accession:
Q08722
Gene Id:
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight:
110 kDa(Non-reducing)
Purity:
>95%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.2EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS pH7.2, 5% trehalose
Quality Statement:
CD47 (Cluster of Differentiation 47), also known as integrin associated protein (IAP), is a transmembrane protein that in humans is encoded by the CD47 gene. It belongs to the immunoglobulin superfamily and partners with membrane integrins and also binds the ligands thrombospondin-1 (TSP-1) and signal-regulatory protein alpha (SIRPα). CD47 is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. Furthermore, it plays a key role in immune and angiogenic responses. Also CD47 is ubiquitously expressed in human cells and has found to be overexpressed in many different tumor cells.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SUMF1 Protein
NOTCH1 Protein
Popular categories:
p21-Activated Kinase 3
CD70
