Share this post on:

Name:
Biotinylated FOLR1 Protein

Synonyms:
FOLR-1, FBP, FOLR, FRα

Species Name:
Human

Label Name:
Avi Tag, His Tag

Marker Name:
Biotin

Accession:
P15328

Gene Id:
Arg25-Met233RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMGGGSHHHHHHHHGLNDIFEAQKIEWHE

Molecular Weight:
33-40kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Folate receptor alpha (FOLR1), a member of the folate receptor family, is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form with high affinity for binding folate and its reduced derivatives into cells and transport 5-methyltetrahydrofolate into cells. Folate is a necessary component of cell metabolism. Overexpression of FOLR1 may confer a growth advantage to tumors by increasing folate uptake and/or may affect cell proliferation via alternative cell signaling pathways. In healthy individuals, FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is overexpressed in a variety of solid tumours such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma.

Reference:
1. Yantong Liu,Ting Lian &Yang Yao :A systematic review and meta-analysis of higher expression of folate receptor alpha (FOLR1) predicts poor cancer prognosis. Biomarkers, Volume 25, 2020 – Issue 5, Pages 367-374.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free FGF-20 ProteinAccession
Apolipoprotein A-I ProteinFormulation
Popular categories:
BTN1A1
Tyrosine-protein Kinase Lyn

Share this post on:

Author: Adenosylmethionine- apoptosisinducer