Share this post on:

Name:
FGF-basic Protein

Synonyms:
bFGF,FGF-2;Heparin-binding growth factor 2;Basic Fibroblast Growth Factor,FGFB,HBGF-2;FGF2; Fibroblast Growth Factor 2 (Basic)

Species Name:
Bovine

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P03969

Gene Id:
Pro10-Ser155MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Molecular Weight:
17kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.5-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 500mM NaCl, pH8.0.

Quality Statement:
Basic Fibroblast Growth Factor (bFGF), also known as FGF2, is a member of the Fibroblast Growth Factor (FGF) family. It is a highly specific chemotactic and mitogenic factor for many cell types, appears to be involved in remodeling damaged tissue, such as ulcer healing, vascular repair, traumatic brain injury (TBI). bFGF is a critical component of human embryonic stem cell culture medium. In addition, bFGF protein is a heparin-binding cationic protein involved in a variety of pathological conditions including angiogenesis and solid tumour growth. Thus, bFGF is regarded as a target for cancers chemopreventive and therapeutic strategies.

Reference:
J Biol Chem. 1996 Jun 21;271(25):15292-7. doi: 10.1074/jbc.271.25.15292. 2. Biosci Rep. 2017 Apr 10;37(2): BSR20170173. doi: 10.1042/BSR20170173. Print 2017 Apr 28. 3. Biochem Biophys Res Commun. 1986 Mar 13;135(2):541-8. doi: 10.1016/0006-291x(86)90028-8.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Mesothelin ProteinSource
RBP4 ProteinPurity & Documentation
Popular categories:
Natural Killer Group 2, Member D (NKG2D)
Ubiquitin-Like Protein FUBI

Share this post on:

Author: Adenosylmethionine- apoptosisinducer