Name:
FGF-basic Protein
Synonyms:
bFGF,FGF-2;Heparin-binding growth factor 2;Basic Fibroblast Growth Factor,FGFB,HBGF-2;FGF2; Fibroblast Growth Factor 2 (Basic)
Species Name:
Bovine
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P03969
Gene Id:
Pro10-Ser155MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Molecular Weight:
17kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.5-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 500mM NaCl, pH8.0.
Quality Statement:
Basic Fibroblast Growth Factor (bFGF), also known as FGF2, is a member of the Fibroblast Growth Factor (FGF) family. It is a highly specific chemotactic and mitogenic factor for many cell types, appears to be involved in remodeling damaged tissue, such as ulcer healing, vascular repair, traumatic brain injury (TBI). bFGF is a critical component of human embryonic stem cell culture medium. In addition, bFGF protein is a heparin-binding cationic protein involved in a variety of pathological conditions including angiogenesis and solid tumour growth. Thus, bFGF is regarded as a target for cancers chemopreventive and therapeutic strategies.
Reference:
J Biol Chem. 1996 Jun 21;271(25):15292-7. doi: 10.1074/jbc.271.25.15292. 2. Biosci Rep. 2017 Apr 10;37(2): BSR20170173. doi: 10.1042/BSR20170173. Print 2017 Apr 28. 3. Biochem Biophys Res Commun. 1986 Mar 13;135(2):541-8. doi: 10.1016/0006-291x(86)90028-8.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Mesothelin ProteinSource
RBP4 ProteinPurity & Documentation
Popular categories:
Natural Killer Group 2, Member D (NKG2D)
Ubiquitin-Like Protein FUBI