Share this post on:

Name:
FGF-21 Protein

Synonyms:
Fibroblast growth factor 21

Species Name:
Rat

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
Q8VI80

Gene Id:
Ala29-Ser208MAPISDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGTAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGTLYGSPHFDPEACSFRELLLKDGYNVYQSEAHGLPLRLPQKDSQDPATRGPVRFLPMPGLPHEPQEQPGVLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Molecular Weight:
20kDa (Reducing)

Purity:
>95% by SDS-PAGE&RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM PB,500mM NaCl,pH 7.4.

Quality Statement:
Fibroblast Growth Factor 21(FGF-21) is a member of the fibroblast growth factor (FGF) family and it is involved in the modulation of cell proliferation, growth, and differentiation as well as cell metabolism. This protein is a secreted endocrine factor that functions as a major metabolic regulator, and stimulates the uptake of glucose in adipose tissue. FGF21 binds to FGFR1c complexed with β-Klotho expressed in adipocytes to activate the canonical FGF signaling pathway (ERK1/2) and the AMPK/PGC1α pathway. Therefore, FGF-21 is being pursued as a therapeutic target for diabetes and obesity.

Reference:
1. J Clin Invest. 2005 Jun;115(6):1627-35. doi: 10.1172/JCI23606. Epub 2005 May 2.2. Exp Gerontol. 2020 Oct 1;139:111022. doi: 10.1016/j.exger.2020.111022.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SKP1 Proteincustom synthesis
ZWINT ProteinMedChemExpress
Popular categories:
Fc Receptor-like 4
Fc Receptor Like 1 (FCRL1)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer