Share this post on:

Name :
IL3 (Human) Recombinant Protein

Biological Activity :
Human IL3 (P08700, 20 a.a. – 152 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
P08700

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3562

Amino Acid Sequence :
APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Molecular Weight :
15

Storage and Stability :
Store at -20°C on dry atmosphere for 2 years.After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
Ion exchange column and HPLC reverse phase column

Quality Control Testing :

Storage Buffer :
Lyophilized from PBS, pH 7.0

Applications :
Functional Study, SDS-PAGE,

Gene Name :
IL3

Gene Alias :
IL-3, MCGF, MGC79398, MGC79399, MULTI-CSF

Gene Description :
interleukin 3 (colony-stimulating factor, multiple)

Gene Summary :
The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq

Other Designations :
P-cell stimulating factor|hematopoietic growth factor|interleukin 3|mast-cell growth factor|multilineage-colony-stimulating factor

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SHH ProteinBiological Activity
NT-4 ProteinFormulation
Popular categories:
Pregnane X Receptor
CD8b

Share this post on:

Author: Adenosylmethionine- apoptosisinducer