Name :
FGF5 (Human) Recombinant Protein
Biological Activity :
Human FGF5 (P12034) recombinant protein expressed in E.Coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of activity analysis
Protein Accession No. :
P12034
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2250
Amino Acid Sequence :
MAWAHGEKRLAPKGQPGPAATDRNPIGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKNPPSPIKSKIPLSAPRKNTNSVKYRLKFRFG
Molecular Weight :
27.7
Storage and Stability :
Stored at -20°C to-80°C for 12 month.After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.Aliquot to avoid repeated freezing and thawing.If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
This product is produced with no animal or human origin raw products. All processing and handling employs animal free equipment and animal free protocols.
Purification :
Quality Control Testing :
Reducing and Non-Reducing SDS PAGE
Storage Buffer :
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate and 100 mM sodium chloride, pH 7.5.
Applications :
Western Blot, Functional Study,
Gene Name :
FGF5
Gene Alias :
HBGF-5, Smag-82
Gene Description :
fibroblast growth factor 5
Gene Summary :
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations :
heparin-binding growth factor 5
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MCP-1/CCL2 Proteincustom synthesis
IL-3 Proteinweb
Popular categories:
Ubiquitin Conjugating Enzyme E2 R2
Cathepsin V/Cathepsin L2
