Name :
CD80 (Human) Recombinant Protein
Biological Activity :
Purified CD80 (AAH11399.2, 137 a.a. – 230 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Protein Accession No. :
AAH11399.2
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=941
Amino Acid Sequence :
SVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFN
Molecular Weight :
15.62
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Mouse (59)
Preparation Method :
Transfection of pSuper-CD80 plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
Purification :
Strep-Tactin affinity columns
Quality Control Testing :
Storage Buffer :
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Applications :
Western Blot, Enzyme-linked Immunoabsorbent Assay, SDS-PAGE, Protein Interaction,
Gene Name :
CD80
Gene Description :
CD80 molecule
Gene Summary :
The B-lymphocyte activation antigen B7-1 (formerly referred to as B7) provides regulatory signals for T lymphocytes as a consequence of binding to the CD28 (MIM 186760) and CTLA4 (MIM 123890) ligands of T cells.[supplied by OMIM
Other Designations :
B-lymphocyte activation antigen B7|CD80 antigen|CD80 antigen (CD28 antigen ligand 1, B7-1 antigen)|costimulatory factor CD80|costimulatory molecule variant IgV-CD80
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Cytokeratin 6 Antibody Protocol PMS2 Antibody web PMID:34384245 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
