Name :
Il5 (Rat) Recombinant Protein
Biological Activity :
Rat IL5 (Q08125, 20 a.a. – 132 a.a.) partial recombinant protein expressed in CHO cell.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
Q08125
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=24497
Amino Acid Sequence :
MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
Molecular Weight :
13-21
Storage and Stability :
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Mammals
Interspecies Antigen Sequence :
Preparation Method :
Mammalian cell (CHO) expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from PBS up to 100 ug/ml
Applications :
Functional Study， SDS-PAGE，
Gene Name :
Il5
Gene Alias :
–
Gene Description :
interleukin 5
Gene Summary :
eosinophil)
Other Designations :
Interleukin 5 (colony-stimulating factor eosinophil)|Interleukin 5 (colony-stimulating factor, eosinophil)
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cathepsin B Proteinsupplier
Fractalkine/CX3CL1 Proteinweb
Popular categories:
Frizzled
Carbonic Anhydrase 5B (CA-VB)
