Share this post on:

Name :
EGF (Human) Recombinant Protein

Biological Activity :
Human EGF (P01133, 971 a.a. – 1023 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in CHO cell.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :
Result of bioactivity analysis

Protein Accession No. :
P01133

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1950

Amino Acid Sequence :
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Molecular Weight :
33-37

Storage and Stability :
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Mammals

Interspecies Antigen Sequence :

Preparation Method :
Mammalian cell (CHO) expression system

Purification :

Quality Control Testing :

Storage Buffer :
Lyophilized from sterile distilled Water up to 100 ug/mL

Applications :
Functional Study, SDS-PAGE,

Gene Name :
EGF

Gene Alias :
HOMG4, URG

Gene Description :
epidermal growth factor (beta-urogastrone)

Gene Summary :
Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. [provided by RefSeq

Other Designations :
urogastrone

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GDNF family web
CD73/5′-Nucleotidase ProteinFormulation
Popular categories:
RELT TNF Receptor
IL-9

Share this post on:

Author: Adenosylmethionine- apoptosisinducer