Name :
YBX1 (Human) Recombinant Protein
Biological Activity :
Human YBX1 (NP_004550, 1 a.a. – 324 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
P67809
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=4904
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSMSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
Molecular Weight :
38.3
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. SDS-PAGE analysis of YBX1 (Human) Recombinant Protein
Storage Buffer :
In PBS, pH 7.4 (20% glycerol).
Applications :
SDS-PAGE,
Gene Name :
YBX1
Gene Alias :
BP-8, CSDA2, CSDB, DBPB, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP-1, NSEP1, YB-1, YB1
Gene Description :
Y box binding protein 1
Gene Summary :
class II
Other Designations :
DNA-binding protein B|OTTHUMP00000008731|major histocompatibility complex, class II, Y box-binding protein I|nuclease sensitive element binding protein 1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-12 Recombinant Proteins
Cathepsin D ProteinAccession
Popular categories:
M-CSF R
Cadherin-11
