Share this post on:

Name :
LGALS9 (Human) Recombinant Protein

Biological Activity :
Human LGALS9 recombinant protein with polyhistidine tag at the N-terminus expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :
Result of activity analysis

Protein Accession No. :

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3965

Amino Acid Sequence :
AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT with polyhistidine tag at the N-terminus.

Molecular Weight :

Storage and Stability :
Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year. Avoid repeated freeze/thaw cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :
SDS-PAGE Stained with Coomassie Blue. SDS-PAGE analysis of LGALS9 (Human) Recombinant Protein.

Storage Buffer :
Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.

Applications :
Functional Study, SDS-PAGE,

Gene Name :
LGALS9

Gene Alias :
HUAT, LGALS9A, MGC117375, MGC125973, MGC125974

Gene Description :
lectin, galactoside-binding, soluble, 9

Gene Summary :
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin’s disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq

Other Designations :
ecalectin|galectin 9|galectin-9|urate transporter/channel protein

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GM-CSF ProteinGene ID
IFN-α/β Receptor Recombinant Proteins
Popular categories:
Integrin alpha M beta 2
MIP-1 gamma/CCL9/CCL10

Share this post on:

Author: Adenosylmethionine- apoptosisinducer