Name :
CYTL1 (Human) Recombinant Protein
Biological Activity :
Human CYTL1 (Q9NRR1, 23 a.a.- 136 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Tag :
Protein Accession No. :
Q9NRR1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=54360
Amino Acid Sequence :
MKHHHHHHASTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR.
Molecular Weight :
14.6
Storage and Stability :
Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
CYTL1 was filtered (0.4 um) and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl, pH 7.5.
Applications :
SDS-PAGE，
Gene Name :
CYTL1
Gene Alias :
C17, C4orf4
Gene Description :
cytokine-like 1
Gene Summary :
C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 [PubMed 10857752]).[supplied by OMIM
Other Designations :
cytokine-like protein C17
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-31 ProteinAccession
CREG1/CREG ProteinFormulation
Popular categories:
Leukocyte Ig-Like Receptor B4
ADAM1/Fertilin alpha
