Name :
FLT3LG (Monkey) Recombinant Protein
Biological Activity :
Monkey FLT3LG recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
F6ZGW9
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=719239
Amino Acid Sequence :
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVPSNLQDEELCGALWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQHPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPRSPGALEATALTAPQRP
Molecular Weight :
18
Storage and Stability :
Lyophilized protein at room temperature for 3 weeks, should be stored at -20°C. Protein aliquots at 4°C for 2-7 days and should be stored at -20°C to -80°C. Avoid repeated freeze/thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
chromatographic
Quality Control Testing :
Storage Buffer :
Lyophilized from a solution containing 1X PBS, pH7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Applications :
Functional Study，
Gene Name :
LOC719239
Gene Alias :
–
Gene Description :
similar to SL cytokine precursor (Fms-related tyrosine kinase 3 ligand) (Flt3 ligand) (Flt3L)
Gene Summary :
Other Designations :
–
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TREM-1/CD354 web
IL-1 alpha ProteinPurity & Documentation
Popular categories:
Jagged-1/CD339
ALK-4/Activin RIB
