Name :
Cd40lg (Mouse) Recombinant Protein
Biological Activity :
Mouse Cd40lg (P27548, 112 a.a. – 260 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.
Tag :
Protein Accession No. :
P27548
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=21947
Amino Acid Sequence :
MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKLHHHHHH.
Molecular Weight :
17.2
Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Host :
Nicotiana benthamiana
Interspecies Antigen Sequence :
Preparation Method :
Baculovirus expression system
Purification :
Quality Control Testing :
Storage Buffer :
PBS (pH7.4) and 10% glycerol.
Applications :
SDS-PAGE，
Gene Name :
Cd40lg
Gene Alias :
CD154, Cd40l, HIGM1, IGM, IMD3, Ly-62, Ly62, T-BAM, TRAP, Tnfsf5, gp39
Gene Description :
CD40 ligand
Gene Summary :
member 5
Other Designations :
OTTMUSP00000019349|tumor necrosis factor (ligand) superfamily, member 5
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-23 Receptor Recombinant Proteins
Neurotrophin-4 ProteinFormulation
Popular categories:
MASP-1
Ubiquitin-Like Protein FUBI
