OSM Protein FGF-8e Protein
OSM, Oncostatin M, MGC20461, OncoMFGF-8e, AIGF, HBGF 8e, KAL6
Human Human
No TagNo Tag
UnconjugatedUnconjugated
Ala26-Arg221MAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRGln23-Arg233MQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
22kDa26kDa
>95% by SDS-PAGE＞95% by SDS-PAGE and HPLC
Lyophilized PowderLyophilized Powder
<1EU/μg<0.1EU/μg
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
20mM Tris, 150mM NaCl, pH8.0, 1mM TCEP20mM PB, 150mM NaCl, pH7.4
Oncostatin M (OSM) was initially identified as a polypeptide cytokine which inhibited the in vitro growth of cells from melanoma and other solid tumors. OSM shows significant similarities in primary amino acid sequence and predicted secondary structure to leukemia inhibitory factor (LIF), ciliary neurotrophic factor (CNTF), granulocyte colony-stimulating factor (G-CSF), interleukin 6 (IL-6), and interleukin 11 (IL-11). The antiproliferative activity of oncostatin M for some cell lines is synergised by TGF-beta and IFN-gamma. It promotes the growth of human fibroblasts, vascular smooth muscle cells, and some normal cell lines. Other OSM-mediated activities reported to date include: stimulation of plasminogen activator activity in cultured bovine aortic endothelial cells; regulation of IL-6 expression in human endothelial cells; and stimulation of LDL uptake and up-regulation of cell surface LDL receptors in HepG2 cells.Fibroblast growth factor 8e (FGF-8e), a secreted heparin-binding protein, is a member of the fibroblast growth factor (FGF) family and is an isoform of FGF-8. Alternative splicing of fgf-8 gene gives rise to potentially four (a, b, e, f) different protein isoforms in human. FGF-8 is widely expressed during embryogenesis, and mediates epithelial-mesenchymal transitions. It plays an organizing and inducing role during gastrulation, and regulates patterning of the midbrain/hindbrain, eye, ear, limb and heart in the embryo.
1、Tanaka M. et al. (2003) Oncostatin M, a multifunctional cytokine. Rev Physiol Biochem Pharmacol. Reviews of Physiology, Biochemistry and Pharmacology. 149: 39-52.2、Auguste P, et al. (1997) Signaling of type II oncostatin M receptor. J Biol Chem. 272(25): 15760-15764.1、Valve E M. et al. (2001) Increased expression of FGF-8 isoforms and FGF receptors in human premalignant prostatic intraepithelial neoplasia lesions and prostate cancer. Lab Invest. 81(6): 815-826.
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations: PD-1 Protein TGFBI Protein NEDD8 C-Type Lectin Domain Containing 6A/Dectin-2
