Name:
PD-L1 Protein
Synonyms:
Programmed cell death 1 ligand 1, CD274, B7-H1, Programmed death ligand 1
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
Q9NZQ7
Gene Id:
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERHHHHHH
Molecular Weight:
30-35 KD(Reducing)
Purity:
＞95%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH 7.2,5% trehalose
Quality Statement:
PD-L1, also known as B7-H1 and CD274, is a 290 amino acid transmembrane glycoprotein in the B7 family of immune regulatory molecules. It has an extracellular domain that can interact with PD-1, which belongs to the CD28/CTLA4 family expressed on activated lymphoid cells. The PD1/PD-L1 interaction ensures that activation of the immune system occurs at the appropriate time. This will minimize the possibility of chronic autoimmune inflammation. PD-L1 is known to inhibit proliferation of T cells via apoptosis. It also plays an important role in arresting cell-cycle progression. This makes PD-L1 an attractive therapeutic target for cancer and immunologic diseases.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
RNASET2 Protein
CXCL16 Protein
Popular categories:
Macrophage CD Proteins
Melanoma Cell Adhesion Molecule (MCAM)
