Share this post on:

Name:
FCAR/CD89 Protein

Synonyms:
Immunoglobulin Alpha Fc Receptor; IgA Fc Receptor; CD89; FCAR

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P24071-1

Gene Id:
QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNGGGSGGGSHHHHHHHHHH

Molecular Weight:
42-55 kDa(Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
FCAR, also known as Fc alpha RI or CD89, is a 50-100 kDa glycosylated bone marrow-specific type I transmembrane (TM) Fc receptor, which is a member of the immunoglobulin gene superfamily. FCAR exists on the surface of myeloid cells such as neutrophils, monocytes, macrophages and eosinophils, and mediates the immune response to pathogens. It interacts with IgA-regulated targets and triggers a variety of immune defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity and stimulating the release of inflammatory mediators. This product is made by recombinant expression of human FCAR from HEK293 cell line, purified, sterilized, filtered, packaged and freeze-dried.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-27 Protein
LSP1 Protein
Popular categories:
Angiopoietin Like 1
CD305/LAIR-1

Share this post on:

Author: Adenosylmethionine- apoptosisinducer