M-CSF Protein | Adenosylmethionine

Name:
M-CSF Protein

Synonyms:
M-CSF, CSF-1, Lanimostim, Macrophage Colony Stimulating Factor

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P09603-3

Gene Id:
Glu33-Ser190MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Molecular Weight:
19kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
50mM Tris, 300mM NaCl, pH8.0

Quality Statement:
Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), is a hematopoietic growth factor. It can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers. The biological activity of human M-CSF is only active in the disulfide-linked dimeric form, which is bonded at Cys63.

Reference:
1、Sullivan A R. et al. (2014) CSF-1R Signaling in Health and Disease: A Focus on the Mammary Gland. J Mammary Gland Biol Neoplasia. 19: 149-159.2、Griffin J D. et al. (1990) The biology of GM-CSF: regulation of production and interaction with its receptor. Int J Cell Cloning. S1: 35-44.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GARP&Latent TGF beta Complex Protein
CD162/PSGL-1 Protein
Popular categories:
NT-4/5
PDGF-R-beta

Author: Adenosylmethionine- apoptosisinducer

Related Posts