Fc γ RIIIa/CD16a Protein | Adenosylmethionine

Name:
Fc γ RIIIa/CD16a Protein

Synonyms:
Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A, CD16a Antigen, Fc-Gamma RIII-Alpha, Fc-Gamma RIII, Fc-gamma RIIIa, FcRIII, FcRIIIa, FcR-10, IgG Fc Receptor III-2, CD16a, FCGR3A, CD16A, FCG3, FCGR3, IGFR3

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P08637-1

Gene Id:
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVPTISSFFPPGYQGGGSGGGSHHHHHHHHHH

Molecular Weight:
35-45 kDa(Reducing)

Purity:
＞95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
IgG Fc receptor (Fc γ R) is a member of the Ig superfamily, which plays a role in activating or inhibiting immune response. Human Fc γ Rs can be divided into three types: RI (CD64), RII (CD32) and RIII (CD16). CD16 is a low-affinity Fc receptor, which has been identified as Fc γ RIII (a (CD16a) and Fc γ RIIIb (CD16b), respectively. These receptors bind to the Fc portion of the IgG antibody and are encoded by two different highly homologous genes in a cell type-specific manner. In humans, CD16a is a 50-70 kDa type I transmembrane activated receptor expressed in NK cells, T cells, monocytes and macrophages, involved in phagocytosis, secretion of enzymes and inflammatory mediators, antibody-dependent cytotoxicity and clearance of immune complexes. Abnormal expression or mutation of CD16a is associated with susceptibility to viral infection, systemic lupus erythematosus and neutropenia in alloimmune newborns. In humans, mutations in a single amino acid of CD16a may affect susceptibility to autoimmune diseases or response to therapeutic IgG antibodies.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
AG-2 Protein
PTPMT1 Protein
Popular categories:
SMAD1
Muscle-Specific Kinase (MuSK)

Author: Adenosylmethionine- apoptosisinducer

Related Posts