Name:
FOLR3 Protein
Synonyms:
FOLR3, folate receptor 3 (gamma), Folate receptor 3, FR-G, FR-gamma, gamma-Hfr
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
P41439
Gene Id:
QPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDSGGGSHHHHHHHH
Molecular Weight:
33-43kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
FOLR3, also known as folate receptor gamma, is a member of FRs. Folic acid and its reduced derivatives are transported via two widely expressed transporters, the reduced folate carrier (RFC) and the proton-coupled folate transporter (PCFT), and via a family of glycosyl-phosphatidylinositol (GPI)-anchored receptors with limited expression profiles known as folate receptors (FRs). Folate receptors (FR) are high affinity receptors that transport folate via endocytosis. FOLR3 (Folate Receptor Gamma) is a Protein Coding gene. Diseases associated with FOLR3 include Primary Peritoneal Carcinoma and Choriocarcinoma of The Testis. Among its related pathways are Innate Immune System and Folate metabolism. Gene Ontology (GO) annotations related to this gene include folic acid binding. Mature FOLR3 is a glycosylated protein that contains an imperfect carboxy terminal GPI anchor sequence . A fraction of FOLR3 is GPI-linked to the cell surface, but the majority is released as a secreted protein. Mature human FOLR3 shares 74% and 83% amino acid (aa) sequence identity with FOLR1 and FOLR2, respectively. Orthologs of human FOLR3 have not been described in mouse or rat. A genetic polymorphism generates a truncated isoform that lacks the carboxy terminal 139 aa. FOLR3 is expressed by cells of the myelocyte and B lymphocyte lineage as well as by various carcinomas.
Reference:
1、Yoshitomi. et al. 2020 Plasma Homocysteine Concentration is Associated with the Expression Level of Folate Receptor 3. Sci Rep 10(1): 10283.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Chk1 Protein
FABP3 Protein
Popular categories:
Heat Shock Protein 47
DEC-205/CD205
