Name:
IgG4 Fc Protein
Synonyms:
IgG4 Fc;Human IgG4 Fc protein, Ig gamma-4 chain C region, IgG4 Fc
Species Name:
Human
Label Name:
null
Marker Name:
Unconjugated
Accession:
P01861
Gene Id:
ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
Molecular Weight:
30-32 KDa(Reducing)
Purity:
>95%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4, 5% trehalose
Quality Statement:
Immunoglobulin G4 (IgG4), one of the four human IgG subtypes, is a monomer immunoglobulin mainly involved in secondary antibody reaction, which is produced and secreted by B cells. The IgG tetramer consists of two heavy chains (50 kDa) and two light chains (25 kDa) connected by disulfide bonds, which are two identical halves to form a Y shape. After pepsin cleavage, IgG was divided into two F (ab) s with one antIgEn binding site and a highly conserved Fc segment. The Fc segment has a highly conserved n-glycosylation site. IgG4 is the least common IgG among healthy adults, accounting for about 5% of the total IgG library. Although the amino acid sequence of IgG4 is about 90% homologous to other IgG subclasses, IgG4 is unique because it is a univalent function with little or no inflammation, and IgG4 Fc can bind to other Fc from all human IgG subclasses. IgG4 is generally considered to be a protective blocking antibody because it can inhibit or prevent inflammation by binding to inflammatory IgG subclasses or IgE competitive antIgEns. In addition, IgG4 can cause a subset of autoimmune diseases in severe diseases.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Carbonic Anhydrase 2 Protein
Animal-Free CXCL16 Protein
Popular categories:
TGF- β
KIR2DS4
