Name:
UltraNuclease Protein
Synonyms:
SMNE,Nuclease, UltraNuclease, Benzonase
Species Name:
Serratia marcescens
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
P13717
Gene Id:
Asp22-Asn266DTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
Molecular Weight:
27.7kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Liquid
Endotoxin Name:
null
Reconstitution:
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
10mM Tris (pH7.4), 500mM NaCl, 2mM MgCl2, 50% glycerol
Quality Statement:
Multi Nuclease all-around nuclease, also called broad-spectrum nucleic acid enzyme, is a kind of comes from Serratia Marcescens restriction endonuclease. It is capable of degradation of all forms of DNA and RNA (double-stranded, single-stranded, linear, circular or superhelical forms) under a very wide range of conditions (6Murea, 0.1M GuanidineHCl, 0.4%TritonX100, 0.1%SDS, 1mM EDTA, 1mM PMSF). The formation of 3-5 oligonucleotide residues containing 5 ‘-phosphate terminus is widely used to remove nucleic acids from biological products. The expression and purification of this product in Escherichia coli(E.coli) through genetic engineering can not only reduce the viscosity of cell supernatant and cell lysate in scientific research, but also improve the efficiency of protein purification and functional research. It can also be used in virus purification, vaccine production, protein and polysaccharide pharmaceutical industry as a host residual nucleic acid removal reagent, reducing the host residual nucleic acid to the peak (pg) level to improve the efficacy and safety of biological products. And can effectively prevent human peripheral blood monocyte (PBMC) clumping in cell therapy and vaccine research.
Reference:
1.Nestle M, Roberts W K. An Extracellular Nuclease from Serratia marcescens I. PURIFICATION AND SOME PROPERTIES OF THE ENZYME[J]. Journal of Biological Chemistry, 1969, 244.2.Kim W Y, Lee H S, Suh S J, et al. Purification and Cellular Localization of Extracellular Nuclease of Serratia marcescens Expressed in Escherichia coli[J]. Korean Journal of Microbiology, 1994, 32(2):147-154.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-2 Protein
Nectin-2/CD112 Protein
Popular categories:
ADAMTS14
Caspase-3
