Name:
IgG1 Fc Protein
Synonyms:
Ig gamma-1 chain C region;IGHG1
Species Name:
Mouse
Label Name:
null
Marker Name:
Unconjugated
Accession:
AAK53870.1
Gene Id:
VPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Molecular Weight:
28-31 kDa(Reducing)
Purity:
>95%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
Immunoglobulin G (IgG) is a monomer immunoglobulin, mainly involved in secondary antibody reaction, plasma B cell synthesis and secretion, constitute 75% of human serum immunoglobulin. There are four subtypes of human IgG antibodies: IgG1,IgG2,IgG3,IgG4; mice IgG can be divided into five subtypes; IgG1,IgG2A,IgG2B,IgG2C and IgG3; rats have four subtypes: IgG1,IgG2A,IgG2B and IgG2C. The nomenclature of IgG subtypes of different species is independent, so there is no correlation among different genera. The content of IgG1 in serum accounts for about 60%, and the half-life in serum is about 21 days. After pepsin cleavage, IgG1 is divided into two antigenic binding sites F (ab) s and a highly conserved Fc fragment, and Fc has a highly conserved N-glycosylation site. IgG1 is the most potential subtype in tumor immunotherapy. The active form of IgG1 is bivalent monomer, and human IgG1 can also bind to mouse Fc γ receptor, so the obvious effect can be observed in mouse model.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Nucleoside phosphorylase/PNP Protein
KIF11 Protein
Popular categories:
PDGF-R-alpha
Basal Cell Adhesion Molecule (BCAM)
