Name:
Leptin Protein
Species Name:
Rat
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P50596
Gene Id:
Val22-Cys167 MVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC
Molecular Weight:
15kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 80mM NaCl, 5%trehalose, pH8.0
Quality Statement:
Leptin (LEP) is a 16kDa peptide hormone produced mainly by white adipocyte tissue. Leptin is involved in maintaining gastric epithelial cell integrity and gastroprotection. In rats, systemic Leptin is effective in attenuating both ethanol- and aspirin-induced damage to the gastric mucosa. This is correlated with an increase of Leptin production by the stomach during experimentally-induced gastric damage in rats and during H pylori infection in humans. This gastric cytoprotective effect of Leptin involves an increase in blood flow, local production of nitric oxide and prostaglandin E2, and vagus nerve-dependent mechanisms. One of the important functions of Leptin is its role in the regulation of inflammatory processes. There is indeed a large body of evidence that Leptin-mediated signal pathways play an active role in innate and adaptive immunity through alteration of various target genes transcription.
Reference:
1、Wodarski K. et al. (2009) Leptin as a modulator of osteogenesis. Ortop Traumatol Rehabil. 11(1): 1-6.2、Tezapsidis N. et al. (2009) Leptin: a novel therapeutic strategy for Alzheimer’s disease. J Alzheimers Dis. 16(4): 731-740.3、Cai C. et al. (2009) Leptin in non-autoimmune inflammation. Inflamm Allergy Drug Targets. 8(4): 285-291.4、Fernndez-Riejos P. et al. (2010) Role of Leptin in the activation of immune cells. Mediators Inflamm. 2010: 568343.5、Kelesidis T. et al. (2010) Narrative review: the role of Leptin in human physiology: emerging clinical applications. Ann Intern Med. 152(2): 93-100.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD200R1 Protein
Cadherin-6/KCAD Protein
Popular categories:
Ubiquitin-Specific Peptidase 26
Adhesion G Protein-Coupled Receptor G5 (GPR114)
