FGF-1 Protein | Adenosylmethionine

Name:
FGF-1 Protein

Synonyms:
FGF-1, Acidic fibroblast growth factor(aFGF), Heparin-binding growth factor 1(HBGF-1)

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P61148

Gene Id:
Phe16-Asp155 MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Weight:
17-18kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM PB, 150mM NaCl, pH7.4

Quality Statement:
Fibroblast growth factor 1 (FGF-1), known as acidic fibroblast growth factor (FGF-Acidic), is one of the best characterized members of the FGF superfamily. FGF-1 is a powerful mitogen exhibiting strong action on numerous different cell types. It plays a role in various stages of development and morphogenesis, as well as in angiogenesis and wound healing processes. FGF-1 is released extracellularly as a disulfide-linked homodimer and is stored in complex with extracellular heparan sulfate. The association of FGF-1 with heparan sulfate is a prerequisite for its subsequent interaction with FGF receptors. Ligation triggers receptor dimerization, transphosphorylation, and internalization of receptor/FGF complexes.

Reference:
1、Zakrzewska M. et al. (2008) FGF-1: from biology through engineering to potential medical applications. Crit Rev Clin Lab Sci. 45(1): 91-135.2、Pye D A. et al. (2000) Regulation of FGF-1 mitogenic activity by heparan sulfate oligosaccharides is dependent on specific structural features: differential requirements for the modulation of FGF-1 and FGF-2. Glycobiology. 10(11): 1183-1192.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
LCN1/Lipocalin-1 Protein
Nicastrin Protein
Popular categories:
CD68
IL-5 Receptor

Author: Adenosylmethionine- apoptosisinducer

Related Posts