Share this post on:

Name:
FGF-9 Protein

Synonyms:
FGF9, GAF, HBFG-9, MGC119914, MGC119915, SYNS3

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P31371

Gene Id:
Met1-Ser208 MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Weight:
25kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 500mM NaCl, pH8.0

Quality Statement:
FGF9(fibroblast growth factor 9, FGF9) is one of the fibroblast growth factor (FGF) family members. It is widely distributed in various tissues of human body and involved in bone development, angiogenesis, embryonic development, damage repair, cell apoptosis, nerve regeneration, tumor growth and other physiological and pathological processes, and can effectively promote mitosis and cell growth. Current evidence suggests that FGF9 may play a prominent role not only in bone development and growth of cartilage into bone formation and generation, but also has a significant impact on aspects of ovarian cancer, nerve regeneration, gonadal differentiation, there remains much to be discovered and investigated on the functions and mechanisms of FGF18.

Reference:
1、Schmahl J. et al. (2004) Fgf9 induces proliferation and nuclear localization of FGFR2 in Sertoli precursors during male sex determination. Development. 131(15): 3627-36.2、Garcès A. et al. (2000) FGF9: a motoneuron survival factor expressed by medial thoracic and sacral motoneurons. J Neurosci Res. 60(1): 1-9.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ICAM-1/CD54 Protein
AMIGO2 Protein
Popular categories:
ENPP-5
Checkpoint Kinase 1 (Chk1)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer