Name:
CD300f/LMIR3/IREM-1 Protein
Synonyms:
CMRF35-like molecule 1, CD300 molecule-like family member f, CD300f, CD300LF, CLIM1, CLM1, CLM-1, DIgR2, IGSF13, IREM1, IREM-1, LMIR3, NKIR, Pigr3
Species Name:
Human
Label Name:
Human Fc Tag
Marker Name:
Unconjugated
Accession:
Q8TDQ1-1
Gene Id:
Thr20-Ser156TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSGGGSGGGSPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight:
45-70kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
LMIR3, also known as CD300f, CD300LF, IREM-1, CLM-1, IgSF13, DIgR1, and MAIR-V, is a 50‑60 kDa glycoprotein member of the immunoglobulin superfamily. Alternate splicing generates additional isoforms that carry substituted C-terminal tails of varying lengths and sequences following the ECD or transmembrane segment. LMIR3 is expressed on the surface of dendritic cells, monocytes, granulocytes, and mast cells as well as on acute myeloid leukemia (AML) blasts. Pervanadate treatment or antibody cross‑linking of LMIR3 induces phosphorylation of tyrosine residues in the cytoplasmic domain and the subsequent recruitment of phosphatases SHIP, SHP-1, SHP-2, and the p85 alpha subunit of PI3K. LMIR3 ligation can induce cell death and inhibit signaling through multiple receptors including Fc epsilon RI, LMIR4, SCF R, TLR2, TLR3, and TLR9 . In contrast, it enhancesTLR4‑mediated signaling/cytokine production in mast cells through association with the activating signaling protein FcR gamma. In mouse, a splice variant of LMIR3 (known as DIgR2, with a 7 aa insertion in the ECD) inhibits CD4+ T cell activation and in vivo Th1 and CTL responses. LMIR3 is up‑regulated on monocytes surrounding experimentally-induced spinal cord demyelination and functions as a negative regulator of inflammation in the CNS.
Reference:
1.Clark, G.J. et al. (2009) Trends Immunol. 30:209.2.Sui, L. et al. (2004) Biochem. Biophys. Res. Commun. 319:920.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FSTL5 Proteinsupplier
VIP ProteinAccession
Popular categories:
Mannose-binding Protein C
IL-2 Inducible T-Cell Kinase (ITK/TSK)