Name:
IL-4 Protein
Synonyms:
Interleukin-4, B-cell IgG differentiation factor,B-cell growth factor 1,B-cell stimulatory factor 1,IGG1 induction factor,Lymphocyte stimulatory factor 1,IL-4,BSF-1
Species Name:
Mouse
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P07750
Gene Id:
His23-Ser140HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Molecular Weight:
18kDa (Non-reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
Mouse Interleukin-4(IL-4) is a monomeric, Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled four α-helix structure. IL-4 exerts its effects through two receptor complexes, Participates in at least several B-cell activation processes as well as of other cell types. IL-4 is primarily expressed by Th2-biased CD4+T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgG1 and IgE in mouse B cells, acquisition of the Th2 phenotype by CD4+T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL-4 plays a dominant role in the development of allergic inflammation and asthma. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.
Reference:
A Novel Rabies Vaccine Expressing CXCL13 Enhances Humoral Immunity by Recruiting both T Follicular Helper and Germinal Center B cells. Wang Z. et al. J Virol. 2017. AID Recognizes Structured DNA for Class Switch Recombination. Qi Qiao. et al. Molecular Cell. 2017.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
14-3-3 epsilon Proteincustom synthesis
HLA-G Proteinsupplier
Popular categories:
ADAMTS17
CD40 Ligand/CD154