Name:
CD300g/Nepmucin/CLM9 Protein
Synonyms:
CMRF35-Like Molecule 9; CLM-9; CD300 Antigen-Like Family Member G; Triggering Receptor Expressed on Myeloid Cells 4; TREM-4; CD300g; CD300LG; CLM9; TREM4
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
Q6UXG3-1
Gene Id:
Leu19-Arg247LEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLDSTSAEDTSPALSSGSSKPRVSIPMVRGGGSHHHHHHHH
Molecular Weight:
35-72kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
Nepmucin, also known as CMRF35-like molecule 9 (CLM-9), TREM-4 and CD300g, is a 75-95 kDa type I transmembrane O-glycosylated member of the CD300 family of molecules. Nepmucin plays a critical role in promoting lymphocyte transendothelial migration of high endothelial veins and mediates lymphocyte adhesion with endothelial cells by its Ig domain, which is independent of LFA-1 or VLA-4 adhesion pathway. Glycosylated nepmucin with MECA-79 epitope associate with L-selectin to mediate L-selectin-dependent lymphocyte rolling by its mucin-like domain. Expression of nepmucin is down-regulated in tumours and tumour-draining lymph nodes, indicating that the expression of nepmucin is negatively regulated by locally produced signals under these circumstances. Nepmucin induction can significantly improve the killing activity of CIK cells.Receptor which may mediate L-selectin-dependent lymphocyte rollings. Binds SELL in a calcium dependent manner.
Reference:
1.Umemoto, E. et al. (2013) PloS One. 8:e83681.2.Umemoto, E. et al. (2006) J. Exp. Med. 203:1603.3.Takatsu H, et al. (2006) Biochem. Biophys. Res. Commun. 348:183.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
LAMP3/CD208 ProteinAccession
EpCAM/TROP1 ProteinAccession
Popular categories:
GnRH
IL-17A