Share this post on:

Name:
GM-CSFR α Protein

Synonyms:
GMR, CD116, CSF2R, SMDP4

Species Name:
Mouse

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q00941

Gene Id:
LLAPTTPDAGSALNLTFDPWTRTLTWACDTAAGNVTVTSCTVTSREAGIHRRVSPFGCRCWFRRMMALHHGVTLDVNGTVGGAAAHWRLSFVNEGAAGSGAENLTCEIRAARFLSCAWREGPAAPADVRYSLRVLNSTGHDVARCMADPGDDVITQCIANDLSLLGSEAYLVVTGRSGAGPVRFLDDVVATKALERLGPPRDVTASCNSSHCTVSWAPPSTWASLTARDFQFEVQWQSAEPGSTPRKVLVVEETRLAFPSPAPHGGHKVKVRAGDTRMKHWGEWSPAHPLEAEDTRVPGGGSHHHHHHHH

Molecular Weight:
44-60kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
GM-CSF receptor alpha is a member of the cytokine family of receptors. GM-CSF receptor alpha is found in the pseudoautosomal region of the X and Y chromosomes. GM-CSF receptor alpha has different isoform, with some of the isoforms being membrane-bound and others being soluble. Soluble GM-CSF receptor alpha subunit is a soluble isoform of the GMR alpha that is believed to arise exclusively through alternative splicing of the GMR alpha gene product. The sGMR alpha mRNA is expressed in a variety of tissues, but it is not clear which cells are capable of secreting the protein. Hereditary pulmonary alveolar proteinosis (hPAP) is a rare disorder of pulmonary surfactant accumulation and hypoxemic respiratory failure caused by mutations in GM-CSF receptor alpha, which results in reduced GM-CSF-dependent pulmonary surfactant clearance by alveolar macrophages. While no pharmacologic therapy currently exists for hPAP, it was recently demonstrated that endotracheal instillation of wild-type or gene-corrected mononuclear phagocytes results in a significant and durable therapeutic efficacy in a validated murine model of hPAP.

Reference:
1、Prevost J M. et al. (2002) Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) and Inflammatory Stimuli Up-Regulate Secretion of the Soluble GM-CSF Receptor in Human Monocytes: Evidence for Ectodomain Shedding of the Cell Surface GM-CSF Receptor α Subunit. J Immunol. 169(10): 5679-5688.2、Cao Y. et al. (2007) Angiogenesis modulates adipogenesis and obesity. J Clin Invest. 117(9): 2362-2368.3、Fleetwood A J. et al. (2005) Functions of Granulocyte-Macrophage Colony-Stimulating Factor. Crit Rev Immunol. 25(5): 405-428.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MBL1 Protein
IGF-I/IGF-1 Protein
Popular categories:
BTN3A2
IFN-alpha 4

Share this post on:

Author: Adenosylmethionine- apoptosisinducer